PMPCA,Alpha-MPP
  • PMPCA,Alpha-MPP

Anti-PMPCA Antibody 25ul

Ref: AN-HPA021648-25ul
Anti-PMPCA

Información del producto

Polyclonal Antibody against Human PMPCA, Gene description: peptidase (mitochondrial processing) alpha, Alternative Gene Names: Alpha-MPP, INPP5E, KIAA0123, Validated applications: ICC, IHC, WB, Uniprot ID: Q10713, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PMPCA
Gene Description peptidase (mitochondrial processing) alpha
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence VEHEHLVDCARKYLLGVQPAWGSAEAVDIDRSVAQYTGGIAKLERDMSNVSLGPTPIPELTHIMVGLESCSFLEEDFIPFAVLNMMMGGGGSFSAGGPGKGMFSR
Immunogen VEHEHLVDCARKYLLGVQPAWGSAEAVDIDRSVAQYTGGIAKLERDMSNVSLGPTPIPELTHIMVGLESCSFLEEDFIPFAVLNMMMGGGGSFSAGGPGKGMFSR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Alpha-MPP, INPP5E, KIAA0123
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q10713
HTS Code 3002150000
Gene ID 23203
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PMPCA Antibody 25ul

Anti-PMPCA Antibody 25ul