RAB11FIP4,FLJ00131
  • RAB11FIP4,FLJ00131

Anti-RAB11FIP4 Antibody 100ul

Ref: AN-HPA021595-100ul
Anti-RAB11FIP4

Información del producto

Polyclonal Antibody against Human RAB11FIP4, Gene description: RAB11 family interacting protein 4 (class II), Alternative Gene Names: FLJ00131, KIAA1821, MGC11316, RAB11-FIP4, Validated applications: IHC, Uniprot ID: Q86YS3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RAB11FIP4
Gene Description RAB11 family interacting protein 4 (class II)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence VLSVESAGTLPCAPEIPDCVEQGSEVTGPTFADGELIPREPGFFPEDEEEAMTLAPPEGPQELYTDSPMESTQSLEGSVGSPAEKDG
Immunogen VLSVESAGTLPCAPEIPDCVEQGSEVTGPTFADGELIPREPGFFPEDEEEAMTLAPPEGPQELYTDSPMESTQSLEGSVGSPAEKDG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ00131, KIAA1821, MGC11316, RAB11-FIP4
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q86YS3
HTS Code 3002150000
Gene ID 84440
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RAB11FIP4 Antibody 100ul

Anti-RAB11FIP4 Antibody 100ul