LRCH1,CHDC1,KIAA1016
  • LRCH1,CHDC1,KIAA1016

Anti-LRCH1 Antibody 25ul

Ref: AN-HPA021536-25ul
Anti-LRCH1

Información del producto

Polyclonal Antibody against Human LRCH1, Gene description: leucine-rich repeats and calponin homology (CH) domain containing 1, Alternative Gene Names: CHDC1, KIAA1016, Validated applications: ICC, IHC, WB, Uniprot ID: Q9Y2L9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name LRCH1
Gene Description leucine-rich repeats and calponin homology (CH) domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence LHQHVEDGKKDSDSGVGSDNGDKRLSATEPSDEDTVSLNVPMSNIMEEEQIIKEDSCHRLSPVKGEFHQEFQPEPSLLGDSTNSGEERDQFTDRADGLHSEFMNYKATTAEDC
Immunogen LHQHVEDGKKDSDSGVGSDNGDKRLSATEPSDEDTVSLNVPMSNIMEEEQIIKEDSCHRLSPVKGEFHQEFQPEPSLLGDSTNSGEERDQFTDRADGLHSEFMNYKATTAEDC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CHDC1, KIAA1016
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y2L9
HTS Code 3002150000
Gene ID 23143
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-LRCH1 Antibody 25ul

Anti-LRCH1 Antibody 25ul