SLC39A11,C17orf26
  • SLC39A11,C17orf26

Anti-SLC39A11 Antibody 100ul

Ref: AN-HPA021455-100ul
Anti-SLC39A11

Información del producto

Polyclonal Antibody against Human SLC39A11, Gene description: solute carrier family 39, member 11, Alternative Gene Names: C17orf26, Validated applications: ICC, Uniprot ID: Q8N1S5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SLC39A11
Gene Description solute carrier family 39, member 11
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence TASATFESARNLAIGIGIQNFPEGLAVSLPLRGAGFSTWRAFW
Immunogen TASATFESARNLAIGIGIQNFPEGLAVSLPLRGAGFSTWRAFW
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C17orf26
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N1S5
HTS Code 3002150000
Gene ID 201266
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SLC39A11 Antibody 100ul

Anti-SLC39A11 Antibody 100ul