IGF2BP1,IMP-1
  • IGF2BP1,IMP-1

Anti-IGF2BP1 Antibody 100ul

Ref: AN-HPA021367-100ul
Anti-IGF2BP1

Información del producto

Polyclonal Antibody against Human IGF2BP1, Gene description: insulin-like growth factor 2 mRNA binding protein 1, Alternative Gene Names: IMP-1, Validated applications: IHC, WB, Uniprot ID: Q9NZI8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name IGF2BP1
Gene Description insulin-like growth factor 2 mRNA binding protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence DVAAMSLQSHLIPGLNLAAVGLFPASSSAVPPPPSSVTGAAPYSSFMQAPEQEMVQVFIPAQAVGAIIGKK
Immunogen DVAAMSLQSHLIPGLNLAAVGLFPASSSAVPPPPSSVTGAAPYSSFMQAPEQEMVQVFIPAQAVGAIIGKK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names IMP-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NZI8
HTS Code 3002150000
Gene ID 10642
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-IGF2BP1 Antibody 100ul

Anti-IGF2BP1 Antibody 100ul