IER5L,bA247A12.2
  • IER5L,bA247A12.2

Anti-IER5L Antibody 25ul

Ref: AN-HPA021327-25ul
Anti-IER5L

Información del producto

Polyclonal Antibody against Human IER5L, Gene description: immediate early response 5-like, Alternative Gene Names: bA247A12.2, Validated applications: ICC, Uniprot ID: Q5T953, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name IER5L
Gene Description immediate early response 5-like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence PSDFGLHCSSQTTVLDLDTHVVTTVENGYLHQDCCASAHCPCCGQGAPGPGLASAAGCKRKYYPGQEEEEDDEEDAG
Immunogen PSDFGLHCSSQTTVLDLDTHVVTTVENGYLHQDCCASAHCPCCGQGAPGPGLASAAGCKRKYYPGQEEEEDDEEDAG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA247A12.2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5T953
HTS Code 3002150000
Gene ID 389792
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-IER5L Antibody 25ul

Anti-IER5L Antibody 25ul