LRWD1,CENP-33
  • LRWD1,CENP-33

Anti-LRWD1 Antibody 25ul

Ref: AN-HPA021320-25ul
Anti-LRWD1

Información del producto

Polyclonal Antibody against Human LRWD1, Gene description: leucine-rich repeats and WD repeat domain containing 1, Alternative Gene Names: CENP-33, DKFZp434K1815, ORCA, Validated applications: ICC, IHC, Uniprot ID: Q9UFC0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name LRWD1
Gene Description leucine-rich repeats and WD repeat domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence PFLTVNDNLKVSFLLPTLRKVNGKDASSTYSQVENLNRELTSRVTAHWEKFMATLGPEEEAEKAQADFVKSAVRD
Immunogen PFLTVNDNLKVSFLLPTLRKVNGKDASSTYSQVENLNRELTSRVTAHWEKFMATLGPEEEAEKAQADFVKSAVRD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CENP-33, DKFZp434K1815, ORCA
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UFC0
HTS Code 3002150000
Gene ID 222229
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-LRWD1 Antibody 25ul

Anti-LRWD1 Antibody 25ul