AAED1,C9orf21
  • AAED1,C9orf21

Anti-AAED1 Antibody 25ul

Ref: AN-HPA021294-25ul
Anti-AAED1

Información del producto

Polyclonal Antibody against Human AAED1, Gene description: AhpC/TSA antioxidant enzyme domain containing 1, Alternative Gene Names: C9orf21, Validated applications: IHC, Uniprot ID: Q7RTV5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name AAED1
Gene Description AhpC/TSA antioxidant enzyme domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SFLQEANVTLIVIGQSSYHHIEPFCKLTGYSHEIYVDPEREIYKRLGMKRGEEIASSGQ
Immunogen SFLQEANVTLIVIGQSSYHHIEPFCKLTGYSHEIYVDPEREIYKRLGMKRGEEIASSGQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C9orf21
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7RTV5
HTS Code 3002150000
Gene ID 195827
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-AAED1 Antibody 25ul

Anti-AAED1 Antibody 25ul