OXSM,FASN2D
  • OXSM,FASN2D

Anti-OXSM Antibody 25ul

Ref: AN-HPA021293-25ul
Anti-OXSM

Información del producto

Polyclonal Antibody against Human OXSM, Gene description: 3-oxoacyl-ACP synthase, mitochondrial, Alternative Gene Names: FASN2D, FLJ20604, KS, Validated applications: ICC, IHC, WB, Uniprot ID: Q9NWU1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name OXSM
Gene Description 3-oxoacyl-ACP synthase, mitochondrial
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence SSTKGATGHLLGAAGAVEAAFTTLACYYQKLPPTLNLDCSEPEFDLNYVPLKAQEWKTEKRFIGLTNSFGFGGTNATLCIAGL
Immunogen SSTKGATGHLLGAAGAVEAAFTTLACYYQKLPPTLNLDCSEPEFDLNYVPLKAQEWKTEKRFIGLTNSFGFGGTNATLCIAGL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FASN2D, FLJ20604, KS
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NWU1
HTS Code 3002150000
Gene ID 54995
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-OXSM Antibody 25ul

Anti-OXSM Antibody 25ul