MMP8,CLG1
  • MMP8,CLG1

Anti-MMP8 Antibody 100ul

Ref: AN-HPA021221-100ul
Anti-MMP8

Información del producto

Polyclonal Antibody against Human MMP8, Gene description: matrix metallopeptidase 8 (neutrophil collagenase), Alternative Gene Names: CLG1, Validated applications: IHC, Uniprot ID: P22894, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MMP8
Gene Description matrix metallopeptidase 8 (neutrophil collagenase)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence KWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNG
Immunogen KWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CLG1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P22894
HTS Code 3002150000
Gene ID 4317
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MMP8 Antibody 100ul

Anti-MMP8 Antibody 100ul