C9orf78,HCA59
  • C9orf78,HCA59

Anti-C9orf78 Antibody 100ul

Ref: AN-HPA021216-100ul
Anti-C9orf78

Información del producto

Polyclonal Antibody against Human C9orf78, Gene description: chromosome 9 open reading frame 78, Alternative Gene Names: HCA59, HSPC220, Validated applications: ICC, IHC, WB, Uniprot ID: Q9NZ63, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name C9orf78
Gene Description chromosome 9 open reading frame 78
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications ICC, IHC, WB
Sequence KKTEEMLSNQMLSGIPEVDLGIDAKIKNIISTEDAKARLLAEQQNKKKDSETSFVPTNMAVNYVQHNR
Immunogen KKTEEMLSNQMLSGIPEVDLGIDAKIKNIISTEDAKARLLAEQQNKKKDSETSFVPTNMAVNYVQHNR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HCA59, HSPC220
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NZ63
HTS Code 3002150000
Gene ID 51759
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-C9orf78 Antibody 100ul

Anti-C9orf78 Antibody 100ul