APIP,APIP2,CGI-29
  • APIP,APIP2,CGI-29

Anti-APIP Antibody 100ul

Ref: AN-HPA021188-100ul
Anti-APIP

Información del producto

Polyclonal Antibody against Human APIP, Gene description: APAF1 interacting protein, Alternative Gene Names: APIP2, CGI-29, Mmrp19, Validated applications: IHC, WB, Uniprot ID: Q96GX9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name APIP
Gene Description APAF1 interacting protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence MSGCDAREGDCCSRRCGAQDKEHPRYLIPELCKQFYHLGWVTGTGGGISLKHGDEIYIAPSGVQKERIQPEDMFVC
Immunogen MSGCDAREGDCCSRRCGAQDKEHPRYLIPELCKQFYHLGWVTGTGGGISLKHGDEIYIAPSGVQKERIQPEDMFVC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names APIP2, CGI-29, Mmrp19
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96GX9
HTS Code 3002150000
Gene ID 51074
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-APIP Antibody 100ul

Anti-APIP Antibody 100ul