EBAG9,EB9,RCAS1
  • EBAG9,EB9,RCAS1

Anti-EBAG9 Antibody 100ul

Ref: AN-HPA021153-100ul
Anti-EBAG9

Información del producto

Polyclonal Antibody against Human EBAG9, Gene description: estrogen receptor binding site associated, antigen, 9, Alternative Gene Names: EB9, RCAS1, Validated applications: IHC, Uniprot ID: O00559, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name EBAG9
Gene Description estrogen receptor binding site associated, antigen, 9
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGI
Immunogen RGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names EB9, RCAS1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O00559
HTS Code 3002150000
Gene ID 9166
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-EBAG9 Antibody 100ul

Anti-EBAG9 Antibody 100ul