DUSP11,PIR1
  • DUSP11,PIR1

Anti-DUSP11 Antibody 25ul

Ref: AN-HPA021052-25ul
Anti-DUSP11

Información del producto

Polyclonal Antibody against Human DUSP11, Gene description: dual specificity phosphatase 11 (RNA/RNP complex 1-interacting), Alternative Gene Names: PIR1, Validated applications: ICC, Uniprot ID: O75319, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DUSP11
Gene Description dual specificity phosphatase 11 (RNA/RNP complex 1-interacting)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence MSQWHHPRSGWGRRRDFSGRSSAKKKGGNHIPERWKDYLPVGQRMPGTRFIAFKVPLQKSFEKKLAPEECFSPLDLFNKIREQNEELGLIIDLTYTQRYYKPEDLPETVPYLKIFTVGHQVPDDETIFKFKHAVNGFLKENKDNDKLIGV
Immunogen MSQWHHPRSGWGRRRDFSGRSSAKKKGGNHIPERWKDYLPVGQRMPGTRFIAFKVPLQKSFEKKLAPEECFSPLDLFNKIREQNEELGLIIDLTYTQRYYKPEDLPETVPYLKIFTVGHQVPDDETIFKFKHAVNGFLKENKDNDKLIGV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PIR1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75319
HTS Code 3002150000
Gene ID 8446
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DUSP11 Antibody 25ul

Anti-DUSP11 Antibody 25ul