CHPF2,ChSy-3
  • CHPF2,ChSy-3

Anti-CHPF2 Antibody 25ul

Ref: AN-HPA020992-25ul
Anti-CHPF2

Información del producto

Polyclonal Antibody against Human CHPF2, Gene description: chondroitin polymerizing factor 2, Alternative Gene Names: ChSy-3, CSGlcA-T, KIAA1402, Validated applications: ICC, IHC, Uniprot ID: Q9P2E5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CHPF2
Gene Description chondroitin polymerizing factor 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence PCVEAVGERGGPQNPDSRARLDQSDEDFKPRIVPYYRDPNKPYKKVLRTRYIQTELGSRERLLVAVLTSRATLST
Immunogen PCVEAVGERGGPQNPDSRARLDQSDEDFKPRIVPYYRDPNKPYKKVLRTRYIQTELGSRERLLVAVLTSRATLST
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ChSy-3, CSGlcA-T, KIAA1402
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9P2E5
HTS Code 3002150000
Gene ID 54480
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CHPF2 Antibody 25ul

Anti-CHPF2 Antibody 25ul