MRPS24,HSPC335
  • MRPS24,HSPC335

Anti-MRPS24 Antibody 100ul

Ref: AN-HPA020983-100ul
Anti-MRPS24

Información del producto

Polyclonal Antibody against Human MRPS24, Gene description: mitochondrial ribosomal protein S24, Alternative Gene Names: HSPC335, MRP-S24, Validated applications: ICC, WB, Uniprot ID: Q96EL2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MRPS24
Gene Description mitochondrial ribosomal protein S24
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Rat
Applications WB, ICC
Sequence GTFPGCLADQLVLKRRGNQLEICAVVLRQLSPHKYYFLVGYSETLLSYFYKCPVRLHLQTVPSKVVYKY
Immunogen GTFPGCLADQLVLKRRGNQLEICAVVLRQLSPHKYYFLVGYSETLLSYFYKCPVRLHLQTVPSKVVYKY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HSPC335, MRP-S24
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96EL2
HTS Code 3002150000
Gene ID 64951
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MRPS24 Antibody 100ul

Anti-MRPS24 Antibody 100ul