MURC,cavin-4,CAVIN4
  • MURC,cavin-4,CAVIN4

Anti-MURC Antibody 25ul

Ref: AN-HPA020973-25ul
Anti-MURC

Información del producto

Polyclonal Antibody against Human MURC, Gene description: muscle-related coiled-coil protein, Alternative Gene Names: cavin-4, CAVIN4, Validated applications: ICC, IHC, WB, Uniprot ID: Q5BKX8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MURC
Gene Description muscle-related coiled-coil protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence KGKDRTVAEGEECAREMGVDIIARSESLGPISELYSDELSEPEHEAARPVYPPHEGREIPTPEPLKVTFKSQVKVEDDESLLL
Immunogen KGKDRTVAEGEECAREMGVDIIARSESLGPISELYSDELSEPEHEAARPVYPPHEGREIPTPEPLKVTFKSQVKVEDDESLLL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names cavin-4, CAVIN4
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5BKX8
HTS Code 3002150000
Gene ID 347273
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MURC Antibody 25ul

Anti-MURC Antibody 25ul