PHPT1,bA216L13.10
  • PHPT1,bA216L13.10

Anti-PHPT1 Antibody 100ul

Ref: AN-HPA020952-100ul
Anti-PHPT1

Información del producto

Polyclonal Antibody against Human PHPT1, Gene description: phosphohistidine phosphatase 1, Alternative Gene Names: bA216L13.10, CGI-202, DKFZp564M173, HSPC141, PHP14, Validated applications: ICC, IHC, Uniprot ID: Q9NRX4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PHPT1
Gene Description phosphohistidine phosphatase 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence DLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYE
Immunogen DLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA216L13.10, CGI-202, DKFZp564M173, HSPC141, PHP14
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NRX4
HTS Code 3002150000
Gene ID 29085
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PHPT1 Antibody 100ul

Anti-PHPT1 Antibody 100ul