SERTAD2,KIAA0127
  • SERTAD2,KIAA0127

Anti-SERTAD2 Antibody 100ul

Ref: AN-HPA020904-100ul
Anti-SERTAD2

Información del producto

Polyclonal Antibody against Human SERTAD2, Gene description: SERTA domain containing 2, Alternative Gene Names: KIAA0127, Sei-2, TRIP-Br2, Validated applications: ICC, IHC, WB, Uniprot ID: Q14140, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SERTAD2
Gene Description SERTA domain containing 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence SPPALLPEKDSFSSALDEIEELCPTSTSTEAATAATDSVKGTSSEAGTQKLDGPQESRADDSKLMDSLPGNFEITTSTGFLTDLTLDDILFADIDTSMYDFDPCTSSSGTASKMAPVSADDLLKTLAP
Immunogen SPPALLPEKDSFSSALDEIEELCPTSTSTEAATAATDSVKGTSSEAGTQKLDGPQESRADDSKLMDSLPGNFEITTSTGFLTDLTLDDILFADIDTSMYDFDPCTSSSGTASKMAPVSADDLLKTLAP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0127, Sei-2, TRIP-Br2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q14140
HTS Code 3002150000
Gene ID 9792
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SERTAD2 Antibody 100ul

Anti-SERTAD2 Antibody 100ul