NEK1,KIAA1901
  • NEK1,KIAA1901

Anti-NEK1 Antibody 25ul

Ref: AN-HPA020873-25ul
Anti-NEK1

Información del producto

Polyclonal Antibody against Human NEK1, Gene description: NIMA-related kinase 1, Alternative Gene Names: KIAA1901, NY-REN-55, Validated applications: IHC, Uniprot ID: Q96PY6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NEK1
Gene Description NIMA-related kinase 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence NLKAQEDEKGKQNLSDTFEINVHEDAKEHEKEKSVSSDRKKWEAGGQLVIPLDELTLDTSFSTTERHTVGEVIKLGPNGSPRRAWGKSPTDSVLKILGEAELQLQTELLENTTIRSEISPEGEKYKPLITGEKKVQCISHEINPSA
Immunogen NLKAQEDEKGKQNLSDTFEINVHEDAKEHEKEKSVSSDRKKWEAGGQLVIPLDELTLDTSFSTTERHTVGEVIKLGPNGSPRRAWGKSPTDSVLKILGEAELQLQTELLENTTIRSEISPEGEKYKPLITGEKKVQCISHEINPSA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA1901, NY-REN-55
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96PY6
HTS Code 3002150000
Gene ID 4750
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NEK1 Antibody 25ul

Anti-NEK1 Antibody 25ul