GOSR1,GOLIM2,GOS-28
  • GOSR1,GOLIM2,GOS-28

Anti-GOSR1 Antibody 100ul

Ref: AN-HPA020590-100ul
Anti-GOSR1

Información del producto

Polyclonal Antibody against Human GOSR1, Gene description: golgi SNAP receptor complex member 1, Alternative Gene Names: GOLIM2, GOS-28, GOS28, GS28, P28, Validated applications: IHC, WB, Uniprot ID: O95249, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name GOSR1
Gene Description golgi SNAP receptor complex member 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence TGVNDKMAEYTNSAGVPSLNAALMHTLQRHRDILQDYTHEFHKTKANFMAIRERENLMGSVRKDIESYKSGSGVNNRRTELFLKEHDHLRNSDRLIEETISIAMATKENMTSQRGMLKSIHSKMNTLANRFPAVNSLIQRINLRKR
Immunogen TGVNDKMAEYTNSAGVPSLNAALMHTLQRHRDILQDYTHEFHKTKANFMAIRERENLMGSVRKDIESYKSGSGVNNRRTELFLKEHDHLRNSDRLIEETISIAMATKENMTSQRGMLKSIHSKMNTLANRFPAVNSLIQRINLRKR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GOLIM2, GOS-28, GOS28, GS28, P28
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95249
HTS Code 3002150000
Gene ID 9527
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GOSR1 Antibody 100ul

Anti-GOSR1 Antibody 100ul