MPP6,p55T,PALS2
  • MPP6,p55T,PALS2

Anti-MPP6 Antibody 25ul

Ref: AN-HPA020456-25ul
Anti-MPP6

Información del producto

Polyclonal Antibody against Human MPP6, Gene description: membrane protein, palmitoylated 6 (MAGUK p55 subfamily member 6), Alternative Gene Names: p55T, PALS2, VAM-1, Validated applications: IHC, WB, Uniprot ID: Q9NZW5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MPP6
Gene Description membrane protein, palmitoylated 6 (MAGUK p55 subfamily member 6)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence AAPELETLRAMHKAVVDAGITTKLLTDSDLKKTVDESARIQRAYNHYFDLIIINDN
Immunogen AAPELETLRAMHKAVVDAGITTKLLTDSDLKKTVDESARIQRAYNHYFDLIIINDN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names p55T, PALS2, VAM-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NZW5
HTS Code 3002150000
Gene ID 51678
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MPP6 Antibody 25ul

Anti-MPP6 Antibody 25ul