INIP,C9orf80
  • INIP,C9orf80

Anti-INIP Antibody 25ul

Ref: AN-HPA020382-25ul
Anti-INIP

Información del producto

Polyclonal Antibody against Human INIP, Gene description: INTS3 and NABP interacting protein, Alternative Gene Names: C9orf80, HSPC043, hSSBIP1, MISE, SOSS-C, Validated applications: ICC, IHC, WB, Uniprot ID: Q9NRY2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name INIP
Gene Description INTS3 and NABP interacting protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence KEKRKLLMQNQSSTNHPGASIALSRPSLNKDFRDHAEQQHIAAQQKAALQHAHAHSSGYFITQDSAFGNL
Immunogen KEKRKLLMQNQSSTNHPGASIALSRPSLNKDFRDHAEQQHIAAQQKAALQHAHAHSSGYFITQDSAFGNL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C9orf80, HSPC043, hSSBIP1, MISE, SOSS-C
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NRY2
HTS Code 3002150000
Gene ID 58493
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-INIP Antibody 25ul

Anti-INIP Antibody 25ul