TSPAN33,MGC50844
  • TSPAN33,MGC50844

Anti-TSPAN33 Antibody 25ul

Ref: AN-HPA020357-25ul
Anti-TSPAN33

Información del producto

Polyclonal Antibody against Human TSPAN33, Gene description: tetraspanin 33, Alternative Gene Names: MGC50844, Penumbra, Validated applications: ICC, IHC, Uniprot ID: Q86UF1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TSPAN33
Gene Description tetraspanin 33
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence NAIVHYRDDLDLQNLIDFGQKKFSCCGGISYKDWSQNMYFNCSEDNPSRERCSVPYSCCLPTPDQAVINTMCGQGMQAFDYLEASKVIYTNGCIDKLVNWIHSNLFL
Immunogen NAIVHYRDDLDLQNLIDFGQKKFSCCGGISYKDWSQNMYFNCSEDNPSRERCSVPYSCCLPTPDQAVINTMCGQGMQAFDYLEASKVIYTNGCIDKLVNWIHSNLFL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC50844, Penumbra
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q86UF1
HTS Code 3002150000
Gene ID 340348
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TSPAN33 Antibody 25ul

Anti-TSPAN33 Antibody 25ul