PNPLA8,IPLA2-2
  • PNPLA8,IPLA2-2

Anti-PNPLA8 Antibody 25ul

Ref: AN-HPA020083-25ul
Anti-PNPLA8

Información del producto

Polyclonal Antibody against Human PNPLA8, Gene description: patatin-like phospholipase domain containing 8, Alternative Gene Names: IPLA2-2, IPLA2G, iPLA2gamma, Validated applications: ICC, IHC, WB, Uniprot ID: Q9NP80, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PNPLA8
Gene Description patatin-like phospholipase domain containing 8
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence DSGWLKQKNIKQAIKSLKKYSDKSAEKSPFPEEKSHIIDKEEDIGKRSLFHYTSSITTKFGDSFYFLSNHINSYFKRKEKMSQQKENE
Immunogen DSGWLKQKNIKQAIKSLKKYSDKSAEKSPFPEEKSHIIDKEEDIGKRSLFHYTSSITTKFGDSFYFLSNHINSYFKRKEKMSQQKENE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names IPLA2-2, IPLA2G, iPLA2gamma
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NP80
HTS Code 3002150000
Gene ID 50640
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PNPLA8 Antibody 25ul

Anti-PNPLA8 Antibody 25ul