JADE1,JADE-1,PHF17
  • JADE1,JADE-1,PHF17

Anti-JADE1 Antibody 25ul

Ref: AN-HPA020016-25ul
Anti-JADE1

Información del producto

Polyclonal Antibody against Human JADE1, Gene description: jade family PHD finger 1, Alternative Gene Names: JADE-1, PHF17, Validated applications: IHC, WB, Uniprot ID: Q6IE81, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name JADE1
Gene Description jade family PHD finger 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications IHC, WB
Sequence VCKVQEQIFNLYTKLLEQERVSGVPSSCSSSSLENMLLFNSPSVGPDAPKIEDLKWHSAFFRKQMGTSLVHSLKKPHKRDPLQNSPGSEGKTLLKQPDL
Immunogen VCKVQEQIFNLYTKLLEQERVSGVPSSCSSSSLENMLLFNSPSVGPDAPKIEDLKWHSAFFRKQMGTSLVHSLKKPHKRDPLQNSPGSEGKTLLKQPDL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names JADE-1, PHF17
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6IE81
HTS Code 3002150000
Gene ID 79960
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-JADE1 Antibody 25ul

Anti-JADE1 Antibody 25ul