DUSP14,MKP-L,MKP6
  • DUSP14,MKP-L,MKP6

Anti-DUSP14 Antibody 100ul

Ref: AN-HPA019911-100ul
Anti-DUSP14

Información del producto

Polyclonal Antibody against Human DUSP14, Gene description: dual specificity phosphatase 14, Alternative Gene Names: MKP-L, MKP6, Validated applications: ICC, IHC, WB, Uniprot ID: O95147, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DUSP14
Gene Description dual specificity phosphatase 14
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB, ICC
Sequence LPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVS
Immunogen LPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MKP-L, MKP6
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95147
HTS Code 3002150000
Gene ID 11072
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DUSP14 Antibody 100ul

Anti-DUSP14 Antibody 100ul