RINT1,FLJ11785
  • RINT1,FLJ11785

Anti-RINT1 Antibody 100ul

Ref: AN-HPA019875-100ul
Anti-RINT1

Información del producto

Polyclonal Antibody against Human RINT1, Gene description: RAD50 interactor 1, Alternative Gene Names: FLJ11785, RINT-1, Validated applications: IHC, WB, Uniprot ID: Q6NUQ1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RINT1
Gene Description RAD50 interactor 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence PCCSESGDERKNLEEKSDINVTVLIGSKQVSEGTDNGDLPSYVSAFIEKEVGNDLKSLKKLDKLIEQRTVSKMQLEEQVLTISSEIPKRIRSALKNAEESKQFLNQFLEQETHLFS
Immunogen PCCSESGDERKNLEEKSDINVTVLIGSKQVSEGTDNGDLPSYVSAFIEKEVGNDLKSLKKLDKLIEQRTVSKMQLEEQVLTISSEIPKRIRSALKNAEESKQFLNQFLEQETHLFS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ11785, RINT-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6NUQ1
HTS Code 3002150000
Gene ID 60561
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RINT1 Antibody 100ul

Anti-RINT1 Antibody 100ul