WIPI2,ATG18B,Atg21
  • WIPI2,ATG18B,Atg21

Anti-WIPI2 Antibody 25ul

Ref: AN-HPA019852-25ul
Anti-WIPI2

Información del producto

Polyclonal Antibody against Human WIPI2, Gene description: WD repeat domain, phosphoinositide interacting 2, Alternative Gene Names: ATG18B, Atg21, CGI-50, DKFZP434J154, DKFZp686P02188, FLJ12979, FLJ14217, FLJ42984, Validated applications: ICC, IHC, WB, Uniprot ID: Q9Y4P8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name WIPI2
Gene Description WD repeat domain, phosphoinositide interacting 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications ICC, IHC, WB
Sequence ECALMKQHRLDGSLETTNEILDSASHDCPLVTQTYGAAAGKGTYVPSSPTRLAYTDDLGAVGGACLEDEASALRLDEDSEHPPMILRTD
Immunogen ECALMKQHRLDGSLETTNEILDSASHDCPLVTQTYGAAAGKGTYVPSSPTRLAYTDDLGAVGGACLEDEASALRLDEDSEHPPMILRTD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ATG18B, Atg21, CGI-50, DKFZP434J154, DKFZp686P02188, FLJ12979, FLJ14217, FLJ42984
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y4P8
HTS Code 3002150000
Gene ID 26100
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-WIPI2 Antibody 25ul

Anti-WIPI2 Antibody 25ul