FAM20C,DKFZp547D065
  • FAM20C,DKFZp547D065

Anti-FAM20C Antibody 100ul

Ref: AN-HPA019823-100ul
Anti-FAM20C

Información del producto

Polyclonal Antibody against Human FAM20C, Gene description: family with sequence similarity 20, member C, Alternative Gene Names: DKFZp547D065, DMP4, IMAGE:4942737, Validated applications: ICC, Uniprot ID: Q8IXL6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FAM20C
Gene Description family with sequence similarity 20, member C
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence VNSDTRLSPKAAENPDWPHAGAEGAEFLSPGEAAVDSYPNWLKFHIGINRYELYSRHNPAIEALLHDLSSQRITSVAMKSGGTQLKLIM
Immunogen VNSDTRLSPKAAENPDWPHAGAEGAEFLSPGEAAVDSYPNWLKFHIGINRYELYSRHNPAIEALLHDLSSQRITSVAMKSGGTQLKLIM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp547D065, DMP4, IMAGE:4942737
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IXL6
HTS Code 3002150000
Gene ID 56975
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FAM20C Antibody 100ul

Anti-FAM20C Antibody 100ul