PSIP1,LEDGF,p52,p75
  • PSIP1,LEDGF,p52,p75

Anti-PSIP1 Antibody 25ul

Ref: AN-HPA019697-25ul
Anti-PSIP1

Información del producto

Polyclonal Antibody against Human PSIP1, Gene description: PC4 and SFRS1 interacting protein 1, Alternative Gene Names: LEDGF, p52, p75, PSIP2, Validated applications: ICC, IHC, Uniprot ID: O75475, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PSIP1
Gene Description PC4 and SFRS1 interacting protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence KQVETEEAGVVTTATASVNLKVSPKRGRPAATEVKIPKPRGRPKMVKQPCPSESDIITEEDKSKKKGQEEKQPKKQPKKDEEGQ
Immunogen KQVETEEAGVVTTATASVNLKVSPKRGRPAATEVKIPKPRGRPKMVKQPCPSESDIITEEDKSKKKGQEEKQPKKQPKKDEEGQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names LEDGF, p52, p75, PSIP2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75475
HTS Code 3002150000
Gene ID 11168
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PSIP1 Antibody 25ul

Anti-PSIP1 Antibody 25ul