PPID,CYP-40
  • PPID,CYP-40

Anti-PPID Antibody 100ul

Ref: AN-HPA019692-100ul
Anti-PPID

Información del producto

Polyclonal Antibody against Human PPID, Gene description: peptidylprolyl isomerase D, Alternative Gene Names: CYP-40, Validated applications: ICC, IHC, WB, Uniprot ID: Q08752, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PPID
Gene Description peptidylprolyl isomerase D
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence IDSCLEALELDPSNTKALYRRAQGWQGLKEYDQALADLKKAQGIAPEDKAIQAELLKVKQKIKAQKDKEKAV
Immunogen IDSCLEALELDPSNTKALYRRAQGWQGLKEYDQALADLKKAQGIAPEDKAIQAELLKVKQKIKAQKDKEKAV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CYP-40
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q08752
HTS Code 3002150000
Gene ID 5481
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PPID Antibody 100ul

Anti-PPID Antibody 100ul