C22orf42
  • C22orf42

Anti-C22orf42 Antibody 25ul

Ref: AN-HPA019531-25ul
Anti-C22orf42

Información del producto

Polyclonal Antibody against Human C22orf42, Gene description: chromosome 22 open reading frame 42, Validated applications: IHC, Uniprot ID: Q6IC83, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name C22orf42
Gene Description chromosome 22 open reading frame 42
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LSESLSVCLEDFMTSDLSESLSVSLEDFMTSGLSESLSVSLEDLMTPEMAKERYEDYLCWVKMARSRLNEPISSQVLGLLR
Immunogen LSESLSVCLEDFMTSDLSESLSVSLEDFMTSGLSESLSVSLEDLMTPEMAKERYEDYLCWVKMARSRLNEPISSQVLGLLR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6IC83
HTS Code 3002150000
Gene ID 150297
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-C22orf42 Antibody 25ul

Anti-C22orf42 Antibody 25ul