EIF4E2,4EHP,EIF4EL3
  • EIF4E2,4EHP,EIF4EL3

Anti-EIF4E2 Antibody 100ul

Ref: AN-HPA019253-100ul
Anti-EIF4E2

Información del producto

Polyclonal Antibody against Human EIF4E2, Gene description: eukaryotic translation initiation factor 4E family member 2, Alternative Gene Names: 4EHP, EIF4EL3, IF4e, Validated applications: ICC, Uniprot ID: O60573, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name EIF4E2
Gene Description eukaryotic translation initiation factor 4E family member 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence TERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRL
Immunogen TERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 4EHP, EIF4EL3, IF4e
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O60573
HTS Code 3002150000
Gene ID 9470
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-EIF4E2 Antibody 100ul

Anti-EIF4E2 Antibody 100ul