RNF115,CL469780
  • RNF115,CL469780

Anti-RNF115 Antibody 100ul

Ref: AN-HPA019130-100ul
Anti-RNF115

Información del producto

Polyclonal Antibody against Human RNF115, Gene description: ring finger protein 115, Alternative Gene Names: CL469780, ZNF364, Validated applications: ICC, IHC, WB, Uniprot ID: Q9Y4L5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RNF115
Gene Description ring finger protein 115
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC, IHC
Sequence MAEASAAGADSGAAVAAHRFFCHFCKGEVSPKLPEYICPRCESGFIEEVTDDSSFLGGGGSRIDNTTTTHFAELWGHLDHTMFFQDFRPFLSSSPLDQDNRAN
Immunogen MAEASAAGADSGAAVAAHRFFCHFCKGEVSPKLPEYICPRCESGFIEEVTDDSSFLGGGGSRIDNTTTTHFAELWGHLDHTMFFQDFRPFLSSSPLDQDNRAN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CL469780, ZNF364
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y4L5
HTS Code 3002150000
Gene ID 27246
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RNF115 Antibody 100ul

Anti-RNF115 Antibody 100ul