DNAJC25,bA16L21.2.1
  • DNAJC25,bA16L21.2.1

Anti-DNAJC25 Antibody 25ul

Ref: AN-HPA019122-25ul
Anti-DNAJC25

Información del producto

Polyclonal Antibody against Human DNAJC25, Gene description: DnaJ (Hsp40) homolog, subfamily C , member 25, Alternative Gene Names: bA16L21.2.1, Validated applications: ICC, IHC, Uniprot ID: Q9H1X3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DNAJC25
Gene Description DnaJ (Hsp40) homolog, subfamily C , member 25
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence NIKGKEYGEEERLYIIRKSMKMSKSQFDSLEDHQKETFLKRELWIKENYEVYKQEQEEELKKKLANDPRWKRYRRWMKNEGPGRLTFVDD
Immunogen NIKGKEYGEEERLYIIRKSMKMSKSQFDSLEDHQKETFLKRELWIKENYEVYKQEQEEELKKKLANDPRWKRYRRWMKNEGPGRLTFVDD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA16L21.2.1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H1X3
HTS Code 3002150000
Gene ID 548645
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DNAJC25 Antibody 25ul

Anti-DNAJC25 Antibody 25ul