SYNE1,8B,ARCA1
  • SYNE1,8B,ARCA1

Anti-SYNE1 Antibody 100ul

Ref: AN-HPA019113-100ul
Anti-SYNE1

Información del producto

Polyclonal Antibody against Human SYNE1, Gene description: spectrin repeat containing, nuclear envelope 1, Alternative Gene Names: 8B, ARCA1, C6orf98, CPG2, dJ45H2.2, enaptin, KIAA0796, MYNE1, Nesp1, Nesprin-1, SCAR8, SYNE-1B, Validated applications: ICC, IHC, Uniprot ID: Q8NF91, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SYNE1
Gene Description spectrin repeat containing, nuclear envelope 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence SRDLESAMSRALPSEDEEGQDDKDFYLRGAVGLSGDHSALESQIRQLGKALDDSRFQIQQTENIIRSKTPTGPELDTSYKGYMKLLGECSSSIDSVKRLEHKLKEEEESLPGFVNLHSTETQTAGVIDRWEL
Immunogen SRDLESAMSRALPSEDEEGQDDKDFYLRGAVGLSGDHSALESQIRQLGKALDDSRFQIQQTENIIRSKTPTGPELDTSYKGYMKLLGECSSSIDSVKRLEHKLKEEEESLPGFVNLHSTETQTAGVIDRWEL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 8B, ARCA1, C6orf98, CPG2, dJ45H2.2, enaptin, KIAA0796, MYNE1, Nesp1, Nesprin-1, SCAR8, SYNE-1B
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NF91
HTS Code 3002150000
Gene ID 23345
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SYNE1 Antibody 100ul

Anti-SYNE1 Antibody 100ul