MIB1,DIP-1,KIAA1323
  • MIB1,DIP-1,KIAA1323

Anti-MIB1 Antibody 25ul

Ref: AN-HPA019100-25ul
Anti-MIB1

Información del producto

Polyclonal Antibody against Human MIB1, Gene description: mindbomb E3 ubiquitin protein ligase 1, Alternative Gene Names: DIP-1, KIAA1323, MIB, ZZANK2, ZZZ6, Validated applications: ICC, IHC, Uniprot ID: Q86YT6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MIB1
Gene Description mindbomb E3 ubiquitin protein ligase 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence LDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANIVRSGDAAQGAEGGTSQFQVGDLVQVCYDLERIKLLQRGHGEWAEAM
Immunogen LDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANIVRSGDAAQGAEGGTSQFQVGDLVQVCYDLERIKLLQRGHGEWAEAM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DIP-1, KIAA1323, MIB, ZZANK2, ZZZ6
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q86YT6
HTS Code 3002150000
Gene ID 57534
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MIB1 Antibody 25ul

Anti-MIB1 Antibody 25ul