DLEC1,CFAP81,DLC1
  • DLEC1,CFAP81,DLC1

Anti-DLEC1 Antibody 25ul

Ref: AN-HPA019077-25ul
Anti-DLEC1

Información del producto

Polyclonal Antibody against Human DLEC1, Gene description: deleted in lung and esophageal cancer 1, Alternative Gene Names: CFAP81, DLC1, Validated applications: ICC, IHC, Uniprot ID: Q9Y238, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DLEC1
Gene Description deleted in lung and esophageal cancer 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence PPVKSVSRWCIDSELLRKHHLISPEDYYTDTVPFHSAPKGISLPGCSKLTFSCEKRSVQKKELNKKLEDSCRKKLAEFEDELDHTVDSLTWNLTPKAKERTREPLKKASQPRN
Immunogen PPVKSVSRWCIDSELLRKHHLISPEDYYTDTVPFHSAPKGISLPGCSKLTFSCEKRSVQKKELNKKLEDSCRKKLAEFEDELDHTVDSLTWNLTPKAKERTREPLKKASQPRN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CFAP81, DLC1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y238
HTS Code 3002150000
Gene ID 9940
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DLEC1 Antibody 25ul

Anti-DLEC1 Antibody 25ul