RAP1GDS1,SmgGDS
  • RAP1GDS1,SmgGDS

Anti-RAP1GDS1 Antibody 25ul

Ref: AN-HPA019060-25ul
Anti-RAP1GDS1

Información del producto

Polyclonal Antibody against Human RAP1GDS1, Gene description: RAP1, GTP-GDP dissociation stimulator 1, Alternative Gene Names: SmgGDS, Validated applications: ICC, IHC, WB, Uniprot ID: P52306, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RAP1GDS1
Gene Description RAP1, GTP-GDP dissociation stimulator 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB, ICC
Sequence ESSKQFASTNIAEELVKLFKKQIEHDKREMIFEVLAPLAENDAIKLQLVEAGLVECLLEIVQQKVDSDKEDDITELKTGSDLMVLLLLGDESMQKLFEGGKGSVFQRVLSWIPSNNHQLQLAGA
Immunogen ESSKQFASTNIAEELVKLFKKQIEHDKREMIFEVLAPLAENDAIKLQLVEAGLVECLLEIVQQKVDSDKEDDITELKTGSDLMVLLLLGDESMQKLFEGGKGSVFQRVLSWIPSNNHQLQLAGA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names SmgGDS
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P52306
HTS Code 3002150000
Gene ID 5910
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RAP1GDS1 Antibody 25ul

Anti-RAP1GDS1 Antibody 25ul