SLC25A13,ARALAR2
  • SLC25A13,ARALAR2

Anti-SLC25A13 Antibody 25ul

Ref: AN-HPA018997-25ul
Anti-SLC25A13

Información del producto

Polyclonal Antibody against Human SLC25A13, Gene description: solute carrier family 25 (aspartate/glutamate carrier), member 13, Alternative Gene Names: ARALAR2, CITRIN, CTLN2, Validated applications: ICC, IHC, WB, Uniprot ID: Q9UJS0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SLC25A13
Gene Description solute carrier family 25 (aspartate/glutamate carrier), member 13
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC, IHC
Sequence KVALTKRADPAELRTIFLKYASIEKNGEFFMSPNDFVTRYLNIFGESQPNPKTVELLSGVVDQTKDGLIS
Immunogen KVALTKRADPAELRTIFLKYASIEKNGEFFMSPNDFVTRYLNIFGESQPNPKTVELLSGVVDQTKDGLIS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ARALAR2, CITRIN, CTLN2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UJS0
HTS Code 3002150000
Gene ID 10165
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SLC25A13 Antibody 25ul

Anti-SLC25A13 Antibody 25ul