NYNRIN,CGIN1
  • NYNRIN,CGIN1

Anti-NYNRIN Antibody 25ul

Ref: AN-HPA018945-25ul
Anti-NYNRIN

Información del producto

Polyclonal Antibody against Human NYNRIN, Gene description: NYN domain and retroviral integrase containing, Alternative Gene Names: CGIN1, FLJ11811, KIAA1305, Validated applications: IHC, Uniprot ID: Q9P2P1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NYNRIN
Gene Description NYN domain and retroviral integrase containing
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PNLLALQLSDSTLADIIARLQAGQKLSGSSPFSSAFNSLSLDKESGLLMFKGDKKPRVWVVPTQLRRDLIFSVHDVPLGAHQRPEETYKKLRLLGWWPGMQEHVKDYCRSCLFCIPRNLIGSELKVIES
Immunogen PNLLALQLSDSTLADIIARLQAGQKLSGSSPFSSAFNSLSLDKESGLLMFKGDKKPRVWVVPTQLRRDLIFSVHDVPLGAHQRPEETYKKLRLLGWWPGMQEHVKDYCRSCLFCIPRNLIGSELKVIES
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGIN1, FLJ11811, KIAA1305
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9P2P1
HTS Code 3002150000
Gene ID 57523
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NYNRIN Antibody 25ul

Anti-NYNRIN Antibody 25ul