CSDE1,D1S155E,UNR
  • CSDE1,D1S155E,UNR

Anti-CSDE1 Antibody 25ul

Ref: AN-HPA018846-25ul
Anti-CSDE1

Información del producto

Polyclonal Antibody against Human CSDE1, Gene description: cold shock domain containing E1, RNA-binding, Alternative Gene Names: D1S155E, UNR, Validated applications: ICC, IHC, WB, Uniprot ID: O75534, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CSDE1
Gene Description cold shock domain containing E1, RNA-binding
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence NLLHNNGHNGYPNGTSAALRETGVIEKLLTSYGFIQCSERQARLFFHCSQYNGNLQDLKVGDDVEFEVSSDRRTGKPIAVKLVKIKQEILPEERMNGQEVFYLTYTPEDVEGNVQLETGDKIN
Immunogen NLLHNNGHNGYPNGTSAALRETGVIEKLLTSYGFIQCSERQARLFFHCSQYNGNLQDLKVGDDVEFEVSSDRRTGKPIAVKLVKIKQEILPEERMNGQEVFYLTYTPEDVEGNVQLETGDKIN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names D1S155E, UNR
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75534
HTS Code 3002150000
Gene ID 7812
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CSDE1 Antibody 25ul

Anti-CSDE1 Antibody 25ul