CDPF1,C22orf40
  • CDPF1,C22orf40

Anti-CDPF1 Antibody 25ul

Ref: AN-HPA018823-25ul
Anti-CDPF1

Información del producto

Polyclonal Antibody against Human CDPF1, Gene description: cysteine-rich, DPF motif domain containing 1, Alternative Gene Names: C22orf40, LOC150383, Validated applications: ICC, IHC, WB, Uniprot ID: Q6NVV7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CDPF1
Gene Description cysteine-rich, DPF motif domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB, ICC
Sequence RPLGVFECELCTLTAPYSYVGQKPPNTQSMVLLEESYVMKDPFTSDKDRFLVLGSCCSLCSRLVCVGPECSLFYSKRFCLPCVRENINAFPQEIRQDLEKRKAPSK
Immunogen RPLGVFECELCTLTAPYSYVGQKPPNTQSMVLLEESYVMKDPFTSDKDRFLVLGSCCSLCSRLVCVGPECSLFYSKRFCLPCVRENINAFPQEIRQDLEKRKAPSK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C22orf40, LOC150383
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6NVV7
HTS Code 3002150000
Gene ID 150383
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CDPF1 Antibody 25ul

Anti-CDPF1 Antibody 25ul