GCN1,GCN1L,GCN1L1
  • GCN1,GCN1L,GCN1L1

Anti-GCN1 Antibody 25ul

Ref: AN-HPA018799-25ul
Anti-GCN1

Información del producto

Polyclonal Antibody against Human GCN1, Gene description: GCN1 eIF2 alpha kinase activator homolog, Alternative Gene Names: GCN1L, GCN1L1, KIAA0219, Validated applications: ICC, IHC, Uniprot ID: Q92616, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name GCN1
Gene Description GCN1 eIF2 alpha kinase activator homolog
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence EALVTDAGEVTEAGKAYVPPRVLQEALCVISGVPGLKGDVTDTEQLAQEMLIISHHPSLVAVQSGLWPALLARMKIDPEAFITRHLDQIIPRMTTQSPLNQSSMNAMGSLSVLSPDRVLPQLISTITA
Immunogen EALVTDAGEVTEAGKAYVPPRVLQEALCVISGVPGLKGDVTDTEQLAQEMLIISHHPSLVAVQSGLWPALLARMKIDPEAFITRHLDQIIPRMTTQSPLNQSSMNAMGSLSVLSPDRVLPQLISTITA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GCN1L, GCN1L1, KIAA0219
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q92616
HTS Code 3002150000
Gene ID 10985
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GCN1 Antibody 25ul

Anti-GCN1 Antibody 25ul