FOS,AP-1,c-fos
  • FOS,AP-1,c-fos

Anti-FOS Antibody 100ul

Ref: AN-HPA018531-100ul
Anti-FOS

Información del producto

Polyclonal Antibody against Human FOS, Gene description: FBJ murine osteosarcoma viral oncogene homolog, Alternative Gene Names: AP-1, c-fos, Validated applications: ICC, IHC, Uniprot ID: P01100, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FOS
Gene Description FBJ murine osteosarcoma viral oncogene homolog
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence DLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDL
Immunogen DLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AP-1, c-fos
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P01100
HTS Code 3002150000
Gene ID 2353
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FOS Antibody 100ul

Anti-FOS Antibody 100ul