TMEM38B,bA219P18.1
  • TMEM38B,bA219P18.1

Anti-TMEM38B Antibody 100ul

Ref: AN-HPA018465-100ul
Anti-TMEM38B

Información del producto

Polyclonal Antibody against Human TMEM38B, Gene description: transmembrane protein 38B, Alternative Gene Names: bA219P18.1, C9orf87, D4Ertd89e, FLJ10493, TRIC-B, Validated applications: IHC, WB, Uniprot ID: Q9NVV0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TMEM38B
Gene Description transmembrane protein 38B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence FEDTLSWMLFGWQQPFSSCEKKSEAKSPSNGVGSLASKPVDVASDNV
Immunogen FEDTLSWMLFGWQQPFSSCEKKSEAKSPSNGVGSLASKPVDVASDNV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA219P18.1, C9orf87, D4Ertd89e, FLJ10493, TRIC-B
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NVV0
HTS Code 3002150000
Gene ID 55151
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TMEM38B Antibody 100ul

Anti-TMEM38B Antibody 100ul