RBM8A,BOV-1A,BOV-1B
  • RBM8A,BOV-1A,BOV-1B

Anti-RBM8A Antibody 25ul

Ref: AN-HPA018403-25ul
Anti-RBM8A

Información del producto

Polyclonal Antibody against Human RBM8A, Gene description: RNA binding motif protein 8A, Alternative Gene Names: BOV-1A, BOV-1B, BOV-1C, RBM8, RBM8B, Y14, ZNRP, Validated applications: ICC, IHC, WB, Uniprot ID: Q9Y5S9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RBM8A
Gene Description RNA binding motif protein 8A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC, IHC
Sequence MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFV
Immunogen MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BOV-1A, BOV-1B, BOV-1C, RBM8, RBM8B, Y14, ZNRP
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y5S9
HTS Code 3002150000
Gene ID 9939
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RBM8A Antibody 25ul

Anti-RBM8A Antibody 25ul