ADARB1,ADAR2,ADAR2a
  • ADARB1,ADAR2,ADAR2a

Anti-ADARB1 Antibody 100ul

Ref: AN-HPA018277-100ul
Anti-ADARB1

Información del producto

Polyclonal Antibody against Human ADARB1, Gene description: adenosine deaminase, RNA-specific, B1, Alternative Gene Names: ADAR2, ADAR2a, ADAR2a-L1, ADAR2a-L2, ADAR2a-L3, ADAR2b, ADAR2c, ADAR2d, ADAR2g, DRABA2, DRADA2, hRED1, RED1, Validated applications: IHC, Uniprot ID: P78563, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ADARB1
Gene Description adenosine deaminase, RNA-specific, B1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SVNTDFTSDQADFPDTLFNGFETPDKAEPPFYVGSNGDDSFSSSGDLSLSASPVPASLAQPPLPVLPPFPPPSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVV
Immunogen SVNTDFTSDQADFPDTLFNGFETPDKAEPPFYVGSNGDDSFSSSGDLSLSASPVPASLAQPPLPVLPPFPPPSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ADAR2, ADAR2a, ADAR2a-L1, ADAR2a-L2, ADAR2a-L3, ADAR2b, ADAR2c, ADAR2d, ADAR2g, DRABA2, DRADA2, hRED1, RED1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P78563
HTS Code 3002150000
Gene ID 104
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ADARB1 Antibody 100ul

Anti-ADARB1 Antibody 100ul