FAF1,CGI-03,hFAF1
  • FAF1,CGI-03,hFAF1

Anti-FAF1 Antibody 100ul

Ref: AN-HPA018253-100ul
Anti-FAF1

Información del producto

Polyclonal Antibody against Human FAF1, Gene description: Fas (TNFRSF6) associated factor 1, Alternative Gene Names: CGI-03, hFAF1, HFAF1s, UBXD12, UBXN3A, Validated applications: ICC, Uniprot ID: Q9UNN5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FAF1
Gene Description Fas (TNFRSF6) associated factor 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence IPVSKMLLKGWKTGDVEDSTVLKSLHLPKNNSLYVLTPDLPPPSSSSHAGALQESLNQNFMLIITHREVQREYNLNFS
Immunogen IPVSKMLLKGWKTGDVEDSTVLKSLHLPKNNSLYVLTPDLPPPSSSSHAGALQESLNQNFMLIITHREVQREYNLNFS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-03, hFAF1, HFAF1s, UBXD12, UBXN3A
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UNN5
HTS Code 3002150000
Gene ID 11124
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FAF1 Antibody 100ul

Anti-FAF1 Antibody 100ul